PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00244.1_g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 367aa    MW: 41252.1 Da    PI: 5.7511
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00244.1_g00019.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.91.4e-51161451129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPt+eel+++yL+kkv++ k++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat+ g+W
  Rsa1.0_00244.1_g00019.1  16 VPPGFRFHPTEEELLQYYLRKKVNSIKIDL-DVIRDVDLNKLEPWDIQEmcKIGTtPQNDWYFFSHKDKKYPTGTRTNRATTVGFW 100
                              69****************************.9***************962433332455*************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              katg+dk ++s +g+ +g++ktLvfykgrap+g+k+dW+mheyrle
  Rsa1.0_00244.1_g00019.1 101 KATGRDKIIYS-NGRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRLE 145
                              ***********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-5810180IPR003441NAC domain
PROSITE profilePS5100556.16416180IPR003441NAC domain
PfamPF023651.2E-2717144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MMSESMSISV NGQSQVPPGF RFHPTEEELL QYYLRKKVNS IKIDLDVIRD VDLNKLEPWD  60
IQEMCKIGTT PQNDWYFFSH KDKKYPTGTR TNRATTVGFW KATGRDKIIY SNGRRIGMRK  120
TLVFYKGRAP HGQKSDWIMH EYRLEDNVIS PDDLTVHEVV IIIEEASQDE GWVVCRIFKK  180
KNLHKTLNSP IGEASLSGGG GMARTSSSSQ FLNDDSLEQF LELMGRSCKE ELNLDPFMKL  240
PNLESPNSQT FNNNCHVSSP DTNHVVQVSN VVDTSFVTSW SALDRLVASQ LNGPISYSIA  300
AADESQADQD HLALPSLRSP YPNLNRPGSY HDDLSQEHPA DMELWNTTAS SLSSSSDPFC  360
HVSNGSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-4821821170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634628.10.0PREDICTED: NAC domain-containing protein 43-like
RefseqXP_009142445.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP60.0NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A078GQS80.0A0A078GQS8_BRANA; BnaC04g51650D protein
TrEMBLA0A0D3C6M10.0A0A0D3C6M1_BRAOL; Uncharacterized protein
TrEMBLM4FHA80.0M4FHA8_BRARP; Uncharacterized protein
STRINGBra040486.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM77828124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.10.0NAC family protein